<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22113

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMPGVVMDDASIGGLRHRPGSSFSQDGQSYARGETARFNGATNSQAGQTHVNGVGKNTSHDRAIEAPPVHYASRKTIGAPELPHITQGFFPFSKLVNRSVQQCWNDLSDLITELADIQVNAHEFHSSPIPTSGKSSGNQSPENIRKKLRLLEFSHAKRAEFIKLLVLSQWSRQAADVSKLIDIQNFIRTRHQAYTGALQYVGDMKRDLVQAQVANPDLKTALEVLSKGKVESMSNLGYKPPRHLTARETLRKLQKINRLIGVRLVVREKIPPSFRTYRVHDGRVTFVVPGEFELDLSIGEEDEASQFFFVDIRFLFFPSPSVPKGRFLNELEIKINDVLQNSGLTGCFEILHNLVLTNKVNILFKQAAELARSSWSDVLRVELLHRTLVVQYWILKPGAKSWLEIGIKGGFCRPSSGSSGLPSLGLRWMRDGNEVSCENIDFDAENLSMESLLRSVIALHVSHVLSSAYSSIRHSSLYSIGHLSLRAQLTRTEPGDCLLDVQLTETKYLRVSIEPMSGISILSTTPSVSERFDGDRNLEKSSADDIVSRVARLRCNAAIEEIESKVKMLGFEPLNPRAWKIDFRKIFPSNILRFACFSHHLWERNWIVAATSSMDGDSWWVVQLRPTVIAKSPSILDVSRRGQSVLRFAQVVTNGFYPALHKIDDTSLADLGHSLSGILAIHSNARYLSGLQAIKFYPPPHKLTIEPDLRVPDILVRYDASYLPSVFRVAMPVNAKRKSPFKDTIRLAFHGIDPRKKCAIMVAYGSLANPMGAFGQLISNWDRSLVFQKKGGGFAIRLLAPAGHPVIVNLIESLQRLECVLSILESLQRKKIEVRTFSLSSISFVYGPERDLSASINIDLFSNDSLIELNPTDLASSPESLFRLRLHIQFGHHNPHRRIQESLASSLNQASTEAGLEAMVELLTLTLPLMRALDQLMANPSYSEPLRVQVTVRNARSYQIHYPDEGVLFQLVAASHQSRWVWVLRDVSTQENSREHKIATRLREALYTSKGDGWRGLEGGVVSEASQVGNLLRELEKCFAACRADSGHKPTGGAVSPGTSNVTELSVSARAKENMDGTKSEHQDSLATLPNNKNAQSHASSATPKEDIIMID
Length1111
PositionTail
OrganismAspergillus ibericus CBS 121593
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
Aromaticity0.07
Grand average of hydropathy-0.228
Instability index51.02
Isoelectric point9.09
Molecular weight123647.64
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP22113
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      91.04|      28|      37|     655|     687|       1
---------------------------------------------------------------------------
  655-  687 (36.46/35.39)	FYPALHKIddTSLADLghSLSGILaIHSNARYL
  695-  722 (54.59/31.15)	FYPPPHKL..TIEPDL..RVPDIL.VRYDASYL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      90.99|      28|      37|     932|     959|       2
---------------------------------------------------------------------------
  932-  959 (49.04/39.95)	LDQLMANPSYSE...PLRVQVTVRNARSYQI
  967-  997 (41.95/32.89)	LFQLVAASHQSRwvwVLRDVSTQENSREHKI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     107.54|      32|      37|     468|     499|       3
---------------------------------------------------------------------------
  468-  499 (54.38/36.78)	YSSIRHSSLYSIGHLSLRAQLTRTEPGDCLLD
  507-  538 (53.16/35.77)	YLRVSIEPMSGISILSTTPSVSERFDGDRNLE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      84.17|      25|     178|     203|     227|       4
---------------------------------------------------------------------------
  203-  227 (41.80/26.22)	MKRDL.VQAQVANPDLKTALEVLSKG
  383-  408 (42.37/26.67)	LHRTLvVQYWILKPGAKSWLEIGIKG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     255.53|      80|     176|     546|     645|       5
---------------------------------------------------------------------------
  110-  154 (52.79/19.75)	ITELADIQVNA..HEFHSS.......PI.PTSGKSSGNQ.SPENIrkkLRLLEFSH.........................................
  409-  462 (85.25/42.10)	.......................GF..CRPSSG.SSG...LPSLG...LRW......MRDGNEVSCENIDFDAENLSMESLLRSVIA.....LHVSH
  546-  639 (117.49/94.06)	VSRVARLRCNAaiEEIESKvkmlGFePLNPRAWKIDFRKiFPSNI...LRFACFSHhLWERNWIVAATSSMDGDSWWVVQLRPTVIAkspsiLDVSR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     100.51|      30|      32|    1001|    1030|       6
---------------------------------------------------------------------------
 1001- 1030 (51.54/37.93)	LREALYTSKGDGWRGLEGGVVSE.ASQVGNL
 1034- 1064 (48.97/35.60)	LEKCFAACRADSGHKPTGGAVSPgTSNVTEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.00|      18|     604|     228|     245|       7
---------------------------------------------------------------------------
  228-  245 (34.45/24.46)	KVE....SMSNLG..YKPPRHLTA
  830-  853 (21.56/12.13)	KIEvrtfSLSSISfvYGPERDLSA
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP22113 with Med14 domain of Kingdom Fungi

Unable to open file!