Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSDRASSASFRVGPPSPSSPAAGSLKPIQPLAPLSDRFPQTPTSPPLMSVSAQNYATHLVSSQSSPNQATPQPANLSSPPSSAPMSTQASQQPTVGTANSFPTPASSVSGHMPGATSLDESENADKPMGPGSGDTGSTSATMNAAAMQQAEHRRTDHDRQPGGAEVGVRDFAVSGGGDAMEIDSEEPASSNRSGPSLESLQKDFTSAFHLCKSSYVATGPDPSLDLISLYGLGSVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKTEPGAPGGLRHMTMWPEEEWQNQKVFGKEIKMADMDSALHNLQMRAMKMEPGTVPNNEYWEDVLGHEKPSKHATSGDVNKKSVAPPPNGIRIPQPNGTPAPVSEPDRSRPSRGRKRHYDDNSFVGYGEGYADDDDDGAFYSNSEGIGKKKRKKDHVSKISTPLPDRGGSYGVGMFGIGAR |
Length | 454 |
Position | Head |
Organism | Aspergillus ibericus CBS 121593 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.775 |
Instability index | 54.06 |
Isoelectric point | 6.85 |
Molecular weight | 47979.61 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP22111 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 151.21| 48| 62| 14| 75| 1 --------------------------------------------------------------------------- 14- 71 (65.97/47.76) PPSpSSPAAgSLKPIQPLAPLSDRFPqTPTSpplmSVSAQ.NYATHLvssQSSPNQATP 79- 127 (85.24/30.05) PPS.SAPMS.TQASQQPTVGTANSFP.TPAS....SVSGHmPGATSL...DESENADKP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 307.14| 95| 216| 132| 233| 2 --------------------------------------------------------------------------- 132- 233 (154.73/81.73) SGDTG..STSATMNAAAMQQ.....AEHRRTDHDRQPGGAEVGVRDFAVSGGGDAMEIDSEEPA.SSNRSGPSLESLQKDftsafHLCKSSyvATGPDPSLDL.ISLYGLG 349- 452 (152.41/68.55) SGDVNkkSVAPPPNGIRIPQpngtpAPVSEPDRSRPSRGRKRHYDDNSFVGYGEGYADDDDDGAfYSNSEGIGKKKRKKD.....HVSKIS..TPLPDRGGSYgVGMFGIG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 121.89| 34| 42| 258| 291| 3 --------------------------------------------------------------------------- 258- 291 (60.84/33.41) EGKLKGLGLAGRNKPVKTEPGAPGGLRHMTMWPE 303- 336 (61.05/33.55) EIKMADMDSALHNLQMRAMKMEPGTVPNNEYWED --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FYSNSEGIGKKKRKKDHVSKISTPL 2) GYGEGYA | 413 399 | 437 405 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab