<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22109
| Description |
Uncharacterized protein |
| Sequence | MDLDNYRSILDNASVDIWLLIDAALAVASVDYTDEFKRRREGIVERIYTTTSASPPCRNCVANNNAETEKIVEEELNPHGGLFNDDENKKKILEIKQQLEYTNQSEDTLVELLHNLDDIDITFQALKRQKDSNFDSERLAATRKRLHENYKEVANAKKQRKIQVMDLHE |
| Length | 169 |
| Position | Unknown |
| Organism | Lupinus angustifolius (Narrow-leaved blue lupine) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
genistoids sensu lato> core genistoids> Genisteae> Lupinus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.786 |
| Instability index | 42.49 |
| Isoelectric point | 5.03 |
| Molecular weight | 19594.64 |
| Publications | PubMed=27557478
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22109
No repeats found
No repeats found
|