<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22106

Description Uncharacterized protein
SequenceMKSLSLDHWRSYFRSKNLDIFDIIDHAIMVAASDCPKEFSLRRDGIAERLFSCKLTRCVGCDRVELAVSVGNGDDEYDNFNGGCKSGFDRDDVGVEFEAGARKESKVNGGGDKEDHGDMDVNHFSNFSFGDAEALTDEIEEESQYVREVLRIKDILLNREEESDSVLFESLRRLQLMELTVDRLKATGIGKAVNPLRKHGSKEIRQLTRTLIDGWKEIVDEWVKATTSIAASEGTPDSVNISVVDDDEEGLPSPPMDEGAFFVAQAGSIELSQFFDGIDDYGNPRQSGQFSRNRENARKPSVDSHDIEKKKLQASNQISITNKDNKSQLPTKIEADVRLNKPVTADSGPGRPPKSSMQRKSNMEPKMQPKIENTITKRPPIGQQDKSKYSDDAAAEVKLEATKRKLQERYQQAENAKRQRTIQVMELNDLPKQANVHRNPHFKPGNNNRHWGAHPRR
Length457
PositionUnknown
OrganismLupinus angustifolius (Narrow-leaved blue lupine)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> genistoids sensu lato> core genistoids> Genisteae> Lupinus.
Aromaticity0.06
Grand average of hydropathy-0.876
Instability index42.00
Isoelectric point5.82
Molecular weight51487.79
Publications
PubMed=27557478

Function

Annotated function 
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP22106
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      86.19|      24|      24|      60|      83|       1
---------------------------------------------------------------------------
   60-   83 (44.20/23.95)	GCDRVELAVSVGNGDDEYDNFNGG
   87-  110 (42.00/22.46)	GFDRDDVGVEFEAGARKESKVNGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.28|      21|      24|     358|     378|       2
---------------------------------------------------------------------------
  358-  378 (36.46/24.22)	QRKSNMEPKMQPKIENTITKR
  384-  404 (32.82/21.14)	QDKSKYSDDAAAEVKLEATKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.23|      17|      24|     218|     234|       3
---------------------------------------------------------------------------
  218-  234 (28.11/18.73)	IVDEWVKATTSIAASEG
  243-  259 (31.12/21.50)	VVDDDEEGLPSPPMDEG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.39|      12|      24|     140|     151|       4
---------------------------------------------------------------------------
  140-  151 (19.96/13.15)	EEESQYVREVLR
  161-  172 (19.43/12.63)	EESDSVLFESLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      32.55|      10|      26|     287|     296|       5
---------------------------------------------------------------------------
  287-  296 (18.86/13.02)	SGQFS.RNREN
  315-  325 (13.69/ 7.45)	SNQISiTNKDN
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP22106 with Med26 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) DYGNPRQSGQFSRNRENARKPSVDSHDIEKKKLQASNQISITNKDNKSQLPTKIEADVRLNKPVTADSGPGRPPKSSMQRKSNMEPKMQPKIENTITKRPPIGQQDKSKYSDDAAAEVKLEATKRKLQERYQQAENAKRQRTIQVMELNDLPKQANVHRNPHFKPGNNNRHWGAHPRR
280
457










Molecular Recognition Features






MoRF SequenceStartStop




1) RHWGAHPR
449
456