<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22102
| Description |
Uncharacterized protein |
| Sequence | MATPPPMGPPGNPMFEGGGPPPPPQPPGTDMTGICFRDQLWLNTYPLDRNLVFDYFAMSPFYDWTCNNEQLRVRSVHPLDISNLTKMTGIEYILSEVLEPHLFVIRKQKRDSPEKVTPMLAYYILDGSIYQAPQLCNVFAARIGRTLHHIQKAFTIAASKLEKIGYVSDRKSGVLLTFVNVNLIVIPLAGSVDAENESEVLESKVSKETIDLKEVKRIDMILASLQRKLPPAPPPPPFPEGYVPPPTSETEEGTDTKEGTGTQAPTSDPIIDQGPSKRMKF |
| Length | 281 |
| Position | Head |
| Organism | Lupinus angustifolius (Narrow-leaved blue lupine) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
genistoids sensu lato> core genistoids> Genisteae> Lupinus.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.335 |
| Instability index | 53.11 |
| Isoelectric point | 5.50 |
| Molecular weight | 31174.50 |
| Publications | PubMed=27557478
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22102
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 103.96| 20| 212| 9| 28| 1
---------------------------------------------------------------------------
9- 28 (48.93/18.47) PP......GNPMFEGGGPPPPPQPPG
230- 241 (29.93/ 8.94) PP..............APPPPPFPEG
245- 269 (25.10/ 6.51) PPtseteeGTDTKEGTGTQAPTSDP.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.67| 14| 30| 35| 48| 2
---------------------------------------------------------------------------
35- 48 (29.29/21.74) CFRDQLWL.NTYPLD
66- 80 (22.39/15.03) CNNEQLRVrSVHPLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.69| 17| 30| 85| 102| 3
---------------------------------------------------------------------------
85- 102 (26.09/21.48) TKMTGIeYILSEVL..EPHL
117- 135 (26.59/16.71) TPMLAY.YILDGSIyqAPQL
---------------------------------------------------------------------------
|