<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22099
Description |
Uncharacterized protein |
Sequence | MDTTRQQPADPKNSSSTPFRLLQAGPRPREVTASTDLLSHFQLRDTYNSFSKKEFHKVTVADSGYLSRVVGETEIRRGVGMELGQLIDEPAAFTDSLHVTDLRPLDLEFLRGAFTFKENAAVFIPEAEKGLPTISGSASGKERKKRRKEKDKDKSKDKHRDKKEKDKKDKDKKEKKQKKKKKRHREEKEHGGENGEDSHRKHKKKKRREEGGGEGKEGDREKRKKKKHKHSKSGDAEDSKKNGW |
Length | 244 |
Position | Head |
Organism | Chara braunii (Braun's stonewort) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Charophyceae> Charales> Characeae>
Chara.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -1.620 |
Instability index | 39.03 |
Isoelectric point | 9.89 |
Molecular weight | 28012.15 |
Publications | PubMed=30007417
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP22099
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 82.74| 19| 19| 145| 163| 1
---------------------------------------------------------------------------
145- 163 (34.03/12.72) KRRKEKDK..DKSKDKHRDKK
167- 181 (22.78/ 6.03) K....KDK..DKKEKKQKKKK
183- 203 (25.92/ 7.90) RHREEKEHggENGEDSHRKHK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.28| 14| 19| 204| 221| 2
---------------------------------------------------------------------------
204- 221 (19.20/15.89) KKKRREegggEGKEGDRE
224- 237 (25.08/10.22) KKKKHK....HSKSGDAE
---------------------------------------------------------------------------
|