<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22088
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MGAPPPPMGLGPGAPGDPVPTDQTGVCFRDQIWLSTFPLIRASVLDYFALSPFYDGNCNNQLLRNSGKDPALLSTMTTGFEYVVRDAIEPHLFIIRKQVRGRNPEVVTPIAAYYVLDGSIYQAPSLHAVIGSRLARALHHIRGAFTEVATKLDRTLSDLEAKEGDSKGEGDEKKADDSKDSSAKRLLDIREVLRNDQIIASVFQKLPQAPPPPPLPAFLVRPPPQAPVEGSQDQTTEKQQGPSAASGSGAPAMSGGGKDAGGANKQRNKGGEGAVSAPPDQGPAKRARTSVA |
| Length | 292 |
| Position | Head |
| Organism | Chara braunii (Braun's stonewort) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Charophyceae> Charales> Characeae>
Chara.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.453 |
| Instability index | 52.15 |
| Isoelectric point | 7.75 |
| Molecular weight | 30935.53 |
| Publications | PubMed=30007417
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22088
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 107.31| 28| 204| 4| 31| 1
---------------------------------------------------------------------------
4- 31 (57.56/22.84) PPPPMG..LGPGAPGDPVPTDQTGVCFRDQ
211- 240 (49.75/18.92) PPPPLPafLVRPPPQAPVEGSQDQTTEKQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.37| 11| 25| 250| 260| 3
---------------------------------------------------------------------------
250- 260 (20.73/ 9.49) APAMSGGGKDA
277- 287 (21.65/10.23) APPDQGPAKRA
---------------------------------------------------------------------------
|