Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MGAPPPPMGLGPGAPGDPVPTDQTGVCFRDQIWLSTFPLIRASVLDYFALSPFYDGNCNNQLLRNSGKDPALLSTMTTGFEYVVRDAIEPHLFIIRKQVRGRNPEVVTPIAAYYVLDGSIYQAPSLHAVIGSRLARALHHIRGAFTEVATKLDRTLSDLEAKEGDSKGEGDEKKADDSKDSSAKRLLDIREVLRNDQIIASVFQKLPQAPPPPPLPAFLVRPPPQAPVEGSQDQTTEKQQGPSAASGSGAPAMSGGGKDAGGANKQRNKGGEGAVSAPPDQGPAKRARTSVA |
Length | 292 |
Position | Head |
Organism | Chara braunii (Braun's stonewort) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Charophyceae> Charales> Characeae> Chara. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.453 |
Instability index | 52.15 |
Isoelectric point | 7.75 |
Molecular weight | 30935.53 |
Publications | PubMed=30007417 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP22088 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 107.31| 28| 204| 4| 31| 1 --------------------------------------------------------------------------- 4- 31 (57.56/22.84) PPPPMG..LGPGAPGDPVPTDQTGVCFRDQ 211- 240 (49.75/18.92) PPPPLPafLVRPPPQAPVEGSQDQTTEKQQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 42.37| 11| 25| 250| 260| 3 --------------------------------------------------------------------------- 250- 260 (20.73/ 9.49) APAMSGGGKDA 277- 287 (21.65/10.23) APPDQGPAKRA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ANKQRNKG 2) LRNDQIIASVFQKL 3) PAKRARTSVA | 263 193 283 | 270 206 292 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab