<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22085
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MGVKWVMYWQPLVGTVTSSQNFVDLVRAAESIQSVRIGRWNATCATYRPVIRDAPSSAAEVSAAKELFGASFSELPRKYFFVLRQEFIVVEAATSIQAVMERIQLYLNRLSVSFEGVCFQVGDFLVKIGKAIQSQNEVLRGVMIELEYIPTTSLEQSGPLLSEFLAIWQDLASNMSQPGRLVLVEPQYADFGLSDTYSPQHMALQYVLLCVHFLGSMRTVM |
Length | 221 |
Position | Head |
Organism | Chara braunii (Braun's stonewort) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Charophyceae> Charales> Characeae>
Chara.
|
Aromaticity | 0.11 |
Grand average of hydropathy | 0.227 |
Instability index | 39.04 |
Isoelectric point | 5.46 |
Molecular weight | 24776.38 |
Publications | PubMed=30007417
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP22085
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 32.68| 10| 99| 25| 34| 1
---------------------------------------------------------------------------
25- 34 (17.09/12.85) LVRAAESIQS
125- 134 (15.58/11.15) LVKIGKAIQS
---------------------------------------------------------------------------
|