<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22084
Description |
Uncharacterized protein |
Sequence | MDVSYCLQLVDSLDAMFLAMLPLRELNPSLNRTPPSLYAASADGADVEGRIREFLDAACELEANFVNLRLQHQQDRKSVLKKEIATLEAEIREKDALVKKTQASINAWRQQVAAAQLTLEKSLKEV |
Length | 126 |
Position | Head |
Organism | Chara braunii (Braun's stonewort) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Charophyceae> Charales> Characeae>
Chara.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.229 |
Instability index | 33.85 |
Isoelectric point | 5.21 |
Molecular weight | 14128.06 |
Publications | PubMed=30007417
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP22084
No repeats found
No repeats found
|