<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22082

Description Uncharacterized protein
SequenceMASRQQRSESSGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKVSDPSVQADMKLWPFKVVAGSGDKPMISVAYKGESKQFAPEEISSMVLTKMKEIAESYLGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKDKSGGEANVMIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRMVHHLVQEFKRKHXKDITGSARALRRLRTACERAKRTLSTTAQTTIEIDSLYXGIDFYTTITRARFEELNMDLFRKCMDPVEKTLRDAKMDKSQVTEVVLVGGSTRIPKIQQLLSDFFHGKELCKSINPDEAVAYGAAVQAAILTGETSEKVQDLLLLDVTPLSLGIETAGGVMTVLIPRNSTIPTKKEQIFSTYADNQPGVLVQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVTFDIDANGILHVSAEDKSTKQRSKITITNDKGRLSEEEIERMVRDAEKFKSEDEEARKKVEAKNGLENYVYNLRNTVLKDDNVASKLDPADKAKMEKKVEEVISWLDRNQLAETDEFEDKQKELESLCNPIMSKMYASSAGVGGMGGGAGGFPGAGAAASGKSTSGAGNGPVIEEVD
Length664
PositionUnknown
OrganismChara braunii (Braun's stonewort)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Charophyceae> Charales> Characeae> Chara.
Aromaticity0.06
Grand average of hydropathy-0.400
Instability index37.02
Isoelectric point5.44
Molecular weight72070.68
Publications
PubMed=30007417

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
ATPase activity	GO:0016887	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP22082
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     127.00|      33|     243|     326|     376|       1
---------------------------------------------------------------------------
  335-  367 (55.99/37.58)	AKMDKSQVTEVVLVGGSTRIPKIQQLLSDFFHG
  580-  606 (44.04/15.70)	AKMEK.KVEEVI.....SWLDRNQLAETDEFED
  620-  640 (26.97/20.24)	SKMYASSAGVGGMGGGAGGFP............
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      94.64|      31|     259|     209|     243|       3
---------------------------------------------------------------------------
  209-  243 (45.02/41.81)	FDLGG...GTFDVSLLTIedgIFEVKATaGDTHLGGED
  470-  503 (49.61/31.96)	FELSGippAPRGVPQITV...TFDIDAN.GILHVSAED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.61|      19|      21|      15|      33|       5
---------------------------------------------------------------------------
   15-   33 (37.78/26.71)	IGIDLG..TTYSCVGVWQHDR
   37-   57 (29.83/19.62)	IANDQGnrTTPSYVAFTDTER
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP22082 with Med37 domain of Kingdom Viridiplantae
Unable to open file!