<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22081

Description Uncharacterized protein
SequenceMAPRQQKGGNSGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKVSDPSVQADMKLWPFKVVAGSGDKPMISVAYKGESKQFAPEEVSSMVLTKMKEIAESYLGKEVGNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKDKXGGEANVMIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRMVHHLVQEFKRKHXKDITGSARALRRLRTACERAKRTLSTTAQTTIEIDSLYGGIDFYTTITRARFEELNMDLFRKCMDPVEKTLRDAKMDKSQVTEVVLVGGSTRIPKIQQLLSDFFNGKELCKSINPDEAVAYGAAVQAAILTGETSEKVQDLLLLDVTPLSLGIETAGGVMTVLIPRNSTIPTKKEQVFSTYADNQPGVLVQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVXFDIDANGILHVSAEDKSTKQRSKITITNDKGRLSKEEIERMVRDAEKFKSEDEVARKKVDAKNGLENYVYNLRNSVLKDDNVASKLDPADKAKMEKKVEEVMALLDRNQLAELDEFEDKQKELESLCNPIMSKLYASAAGAGGMGGGGAGVFPAGGAAAHGKATAGAAGNGPVIEEVD
Length666
PositionUnknown
OrganismChara braunii (Braun's stonewort)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Charophyceae> Charales> Characeae> Chara.
Aromaticity0.06
Grand average of hydropathy-0.352
Instability index32.25
Isoelectric point5.63
Molecular weight71746.57
Publications
PubMed=30007417

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
ATPase activity	GO:0016887	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP22081
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      96.81|      22|      26|      38|      60|       1
---------------------------------------------------------------------------
   18-   35 (27.18/14.70)	..DLG..TTYSCVGVWQHDR.VE
   38-   60 (35.73/26.41)	ANDQGNrTTPSYVAFTDTERLIG
   63-   83 (33.89/20.00)	AKNQAA.MNPANTVF.DAKRLIG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.11|      26|      26|     565|     590|       2
---------------------------------------------------------------------------
  565-  590 (43.15/25.62)	LKDDNVASKLDP.ADKAK.MEKKVEEVM
  592-  619 (35.96/20.33)	LLDRNQLAELDEfEDKQKeLESLCNPIM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     133.81|      47|     279|     209|     260|       4
---------------------------------------------------------------------------
  209-  260 (71.05/58.43)	FDL.GGGTFDVSlltIEDGIF....EVKATAGDTHLGGEDFDnRMVHHlVQEFK......RKH
  489-  546 (62.76/37.09)	FDIdANGILHVS...AEDKSTkqrsKITITNDKGRLSKEEIE.RMVRD.AEKFKsedevaRKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.25|      12|     237|     140|     154|       8
---------------------------------------------------------------------------
  123-  134 (20.26/11.66)	FAPEEVSSMVLT
  143-  154 (19.99/ 7.38)	YLGKEVGNAVIT
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP22081 with Med37 domain of Kingdom Viridiplantae
Unable to open file!