<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22075

Description Uncharacterized protein
SequenceMLDAADENERPFFQKHYDDAVQREREAEAAARAANIADQVALLRIPEANADRFQEGLAAAVVALVRLRTLENLESRVTALEQRNQELQAEITSLKQSQLSAPRPPNPRSAVILVSQSNTVIVPRVSGTVASAGTGANFMSGNADSSALVTVPNAGTSAQNATVFTGVQYXGPTVDKRAATLPSKYDGKADVTFWISSMRSYFEVMRTPQEDRSMIMGXNTEPTVRNYIELQAVAAGYERIDLTEWLKITPVRTLEDLLLARYQDKHAXLKARLKLEXLKDHRTVAKMSEIAAKRVGISLDPLAIKRIKSIDETGKEEPAEEPSIEEKFLLALGRIDFHHAIPVHTVAKGGEEDEKEREKKKKEAAAKASSQSTWQWQSVVEHFQMVQIELGVIQDVIKEVEANNAVTLAYIPRPRPLMNEKIQELALRVSQKRKQMQVTARYLRKTAQGLGKQVAKEGLFYGALMRLQQNWKVKRSSLRGCGKDGMSWNVFVNPAASSTSGFSIDLSWSLVNPENKLVSSLRPPPIANIVLTQDSAGKLTGSLGSNRTIRIMRCHLTGIAGEREVLRPARSSVSKDDIAKEKDEDAKSSGFSSFDWNDRYPSGGYAGRKKREEGVEIGAEDVHALLRRVQSAVYCEQCHVSSATSAVPRQQCHVSNSATSAVPHQQQCHVSSATSATVPRQQCHVSSATSAVPRQQCHVSNSAMSAVPCQQCHASNNATSAVPRQQCHVTVPRQQCPATMTGAALGMPGQLANESIADYKQRFQTQLAMIEAEEQRQLAAEAARLQAEAAATAEKQRLQAEANADT
Length806
PositionHead
OrganismChara braunii (Braun's stonewort)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Charophyceae> Charales> Characeae> Chara.
Aromaticity0.05
Grand average of hydropathy-0.451
Instability index50.34
Isoelectric point8.80
Molecular weight87956.45
Publications
PubMed=30007417

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP22075
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     227.14|      28|      28|     636|     663|       1
---------------------------------------------------------------------------
   92-  111 (21.23/ 9.36)	......TSL....KQSQLS.AP.RPP..............NPRSAV
  113-  156 (22.22/10.17)	LVSQSNTVIVP.rVSGTVA.SAgTGAnfmsgnadssalvtVPNAGT
  636-  652 (30.05/16.64)	.............EQCHVS.SA.TSA..............VPRQQC
  653-  683 (54.23/36.62)	HVSNSATSAVPhqQQCHVS.SA.TSA.............tVPRQQC
  684-  712 (51.88/34.67)	HVS.SATSAVP.rQQCHVSnSA.MSA..............VPCQQC
  713-  736 (47.53/31.08)	HASNNATSAVP.rQQCHVT.....................VPRQQC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.70|      15|      15|     539|     553|       2
---------------------------------------------------------------------------
  539-  553 (26.09/19.49)	LTGSLGSNRTIRIMR
  556-  570 (25.61/18.99)	LTGIAGEREVLRPAR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.66|      15|      19|     471|     488|       4
---------------------------------------------------------------------------
  473-  488 (24.98/27.91)	V....KRSSLRGCGKDgMSW
  490-  508 (19.68/ 6.38)	VfvnpAASSTSGFSID.LSW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.41|      17|      19|     764|     782|       5
---------------------------------------------------------------------------
  764-  782 (20.92/21.28)	QTQlAMIEAEEQRqLAAEA
  786-  802 (27.49/15.99)	QAE.AAATAEKQR.LQAEA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP22075 with Med17 domain of Kingdom Viridiplantae
Unable to open file!