<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22060

Description mediator of RNA polymerase II transcription subunit 26
SequenceMAMDGLVVSCTPCTRGGGREGEHWQVALVSQIRNMVAVLEVISSLEKYPITKEALEETRLGKLINDVRKKTKNEELAKRAKKLLRSWQKLIDPESFPGALDGSGHTGPEGGRLEHGESDKHSGKIPVNAVRPHTSSPGLGKPPGPCLQTKAAVLQQLDRVDETPGPPHSRGAPRCSFSPRNSRHEGSFARQRSPYTPKGSMPSPSPRPQALDVTQVPSPLPLAQPSTPPVRRLELLPSAESPVRWLEQPEGHQLQGGXXXXXXXESLLPRAGFSPDSSKADSDAASSGGSDSKKKKRYRPRDYTVNLDGQVAEAGVKPVRLKERKLTFDPMTRQIKPLTQKEPVRADSPVHTEQPRTELDKPEAKASVQSPFEQTNWKELSRNEIIQSYLSRQSSLLSSSGAQTPGAHHFMSEYLKQEESTRRGARKPHVLVPHSAPTDLPGLNREVTQDDLDRIQAHQWPGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD
Length500
PositionUnknown
OrganismUrsus maritimus (Polar bear) (Thalarctos maritimus)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Carnivora> Caniformia> Ursidae> Ursus.
Aromaticity0.04
Grand average of hydropathy-0.831
Instability index56.76
Isoelectric point8.91
Molecular weight54318.42
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP22060
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.70|      18|      18|     191|     208|       1
---------------------------------------------------------------------------
  174-  191 (30.61/13.57)	RCSFSPRNSRHEGSFARQ
  192-  209 (35.09/16.61)	RSPYTPKGSMPSPSPRPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     109.12|      33|     130|     218|     254|       3
---------------------------------------------------------------------------
  218-  254 (49.34/33.30)	SPLPLAQPSTpPVRRLELLPSAESPvrwLEQPEGHQL
  348-  380 (59.78/28.11)	SPVHTEQPRT.ELDKPEAKASVQSP...FEQTNWKEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.44|      18|      60|      61|      78|       5
---------------------------------------------------------------------------
   61-   78 (30.10/20.25)	GKL.INDVRKKTKNEELAK
  123-  141 (28.34/18.63)	GKIpVNAVRPHTSSPGLGK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.57|      15|      22|     389|     405|       8
---------------------------------------------------------------------------
  389-  405 (21.68/16.64)	YLSRQSSllSSSGAQTP
  414-  428 (26.89/14.58)	YLKQEES..TRRGARKP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP22060 with Med26 domain of Kingdom Metazoa
Unable to open file!