<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22052
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MEAPPVTMMPVTGGTINMMEYLLQGSVLDHSLESLIHRLRGLCDNMEPETFLDHEMVFLLKGQQASPFVLRARRSMDRGGAPWHLRYLGQPEMGDKNRHALVRNCVDIATSENLTDFLMEMGFRMDHEFVAKGHLFRKGIMKIMVYKIFRILVPGNTDSTEALSLSYLVELSVVAPAGQDMVSDDMRNFAEQLKPLVHLEKIDPKRLM |
Length | 208 |
Position | Head |
Organism | Ursus maritimus (Polar bear) (Thalarctos maritimus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Ursidae> Ursus.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.131 |
Instability index | 38.48 |
Isoelectric point | 6.06 |
Molecular weight | 23676.44 |
Publications | PubMed=24813606
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP22052
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.50| 20| 70| 42| 63| 1
---------------------------------------------------------------------------
42- 63 (33.96/23.98) LCDNMEPETF.LDHEmvFLLKGQ
114- 134 (34.54/18.40) LTDFLMEMGFrMDHE..FVAKGH
---------------------------------------------------------------------------
|