<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22037
Description |
LOW QUALITY PROTEIN: mediator of RNA polymerase II transcription subunit 29 |
Sequence | MASSQQQAAGASSAAGVXGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQIACAKDIHTALLDCANKVTGKTPAPPTGPGGTL |
Length | 194 |
Position | Tail |
Organism | Ursus maritimus (Polar bear) (Thalarctos maritimus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Ursidae> Ursus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.374 |
Instability index | 67.91 |
Isoelectric point | 5.86 |
Molecular weight | 20529.11 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP22037
No repeats found
|