<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22032
| Description |
mediator of RNA polymerase II transcription subunit 28 |
| Sequence | MAAPLGGMFSGQPPGHPGDSRGQASLLQAAPGPPRTSNSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPAEIPQGSLAYLEQASANIPAPMKQT |
| Length | 175 |
| Position | Head |
| Organism | Ursus maritimus (Polar bear) (Thalarctos maritimus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Ursidae> Ursus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.555 |
| Instability index | 57.71 |
| Isoelectric point | 5.58 |
| Molecular weight | 19434.73 |
| Publications | PubMed=24813606
|
Function
| Annotated function |
|
| GO - Cellular Component | cortical actin cytoskeleton GO:0030864 IEA:Ensembl
nucleoplasm GO:0005654 IEA:Ensembl
|
| GO - Biological Function | |
| GO - Biological Process | negative regulation of smooth muscle cell differentiation GO:0051151 IEA:Ensembl
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP22032
No repeats found
|