<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22028

Description mediator of RNA polymerase II transcription subunit 25 isoform X2
SequenceMKSSSVLSSQYGGTQYSLVVFNTVDCAPESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFDDFKKMREQIGQTHRVCLLICNSPPYLLPAVESTTYSGYTTESLVQKIGEQGIHFSIVSPRKLPALRLLFEKAAPPALLEPLQPPADVSQDPRHMVLVRGLVLPVGGGSAPGPLQPKQPVPLPPAPPSGASLSAAPQQPLPPVPQQYQVPGNLSAAQVAAQNAVEAAKNQKAGLGPRFSPINPLQQAAPGVGPPFSQAPAPPLPPGPPGAPKAPPASQPSLVSTVAPGPGLAPPAQPGAPSMAGTVAPGGVSGPSPAQLGAPALGGQQSVSNKLLAWSGVLEWQEKPKPASVDANTKLTRSLPCQVYVNHGENLKTEQWPQKLIMQLIPQQLLTTLGPLFRNSRMVQFHFTNKDLESLKGLYRIMGNGFAGCVHFPHTAPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNGIRQVITNHKQVQQQKLEQQRGMGAQQAPPGLGPILEDQARPSQNLLQLRPPQPQPQGTVGASAASGQPQPQGAAQAPPGAPQGPPGAAPGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWTTQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI
Length696
PositionUnknown
OrganismUrsus maritimus (Polar bear) (Thalarctos maritimus)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Carnivora> Caniformia> Ursidae> Ursus.
Aromaticity0.05
Grand average of hydropathy-0.260
Instability index60.64
Isoelectric point9.21
Molecular weight72832.98
Publications
PubMed=24813606

Function

Annotated function
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP22028
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     199.97|      26|      26|     261|     286|       1
---------------------------------------------------------------------------
  181-  202 (35.06/ 6.76)	GGG..sAPG.....PL..Q.PK..........QPVPL.PPAPP
  261-  283 (48.54/13.07)	...QA.APGV..GPPF..S.QA..........PAPPL.PPGPP
  284-  312 (36.13/ 7.26)	GAPKA.PPAS..QPSLvsT.VA..........PGPGLaPPAQP
  509-  545 (33.63/ 6.09)	GAQQA.PPGL..GPIL..EdQArpsqnllqlrPPQPQ.PQGTV
  558-  583 (46.60/12.16)	GAAQA.PPGApqGPPG..A..A..........PGPP..PPGPI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     122.64|      24|      30|     587|     610|       2
---------------------------------------------------------------------------
  587-  610 (48.15/14.11)	QNPGANPQLRSLLLNPPPPQTGVP
  636-  655 (32.68/ 6.96)	...G.QPQLGPPLLHPPPAQSWTT
  656-  678 (41.81/11.18)	QLPPRAP.LPGQMLLSGGPRGPVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.68|      13|      16|     315|     327|       3
---------------------------------------------------------------------------
  315-  327 (22.65/11.20)	PSMAGTVAPGGVS
  331-  343 (22.04/10.66)	PAQLGAPALGGQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.29|      14|      30|     421|     450|       4
---------------------------------------------------------------------------
   48-   61 (28.08/ 7.79)	LDGI.KFMGGGGESC
  433-  447 (23.21/15.62)	LKGLyRIMGNGFAGC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     111.26|      39|      75|     378|     431|       7
---------------------------------------------------------------------------
  378-  431 (49.05/64.92)	PCQVYVNHGenLKTEQwpQKLIMQLIP..........QQLLTtlgplfrNSRMVQfhftNKDLE
  455-  503 (62.21/36.09)	PCEVRVLML..LYSSK..KKIFMGLIPydqsgfvngiRQVIT.......NHKQVQ....QQKLE
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP22028 with Med25 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) GGSAPGPLQPKQPVPLPPAPPSGASLSAAPQQPLPPVPQQYQVPGNLSAAQVAAQNAVEAAKNQKAGLGPRFSPINPLQQAAPGVGPPFSQAPAPPLPPGPPGAPKAPPASQPSLVSTVAPGPGLAPPAQPGAPSMAGTVAPGGVSGPSPAQLGAPALG
2) HKQVQQQKLEQQRGMGAQQAPPGLGPILEDQARPSQNLLQLRPPQPQPQGTVGASAASGQPQPQGAAQAPPGAPQGPPGAAPGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWTTQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMD
182
494
340
694

Molecular Recognition Features

MoRF SequenceStartStop
NANANA