<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22025
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MENFTALFGAQADPPPPPTALGFGAGKPPPPPPPPPGGGPGPAAPPTAASAPSGADKSAAGCGPFYLMRELPGSTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKQKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGVGSSQASSSSSLR |
| Length | 244 |
| Position | Head |
| Organism | Balaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Mysticeti>
Balaenopteridae> Balaenoptera.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.980 |
| Instability index | 63.49 |
| Isoelectric point | 9.83 |
| Molecular weight | 26154.58 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP22025
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 112.86| 26| 39| 169| 194| 1
---------------------------------------------------------------------------
99- 121 (22.45/ 7.66) ........KKVKEKLSN.FLPDLPGMidlpGS
169- 194 (46.94/24.13) QPP..KKKNKQKHKQSRTQDPVPPET....PS
207- 234 (43.47/21.80) EDPerKRKKKEKKKKKNRHSPDHPGV....GS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 29.07| 8| 26| 17| 28| 3
---------------------------------------------------------------------------
17- 28 (12.04/12.62) PPTAlgfgAGKP
45- 52 (17.03/ 6.10) PPTA....ASAP
---------------------------------------------------------------------------
|