<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22021
Description |
mediator of RNA polymerase II transcription subunit 27 isoform X1 |
Sequence | MADVLSVGVNLEAFAQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKILPIPRGPPALTSSGTLSHVTCL |
Length | 139 |
Position | Tail |
Organism | Balaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Mysticeti>
Balaenopteridae> Balaenoptera.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.236 |
Instability index | 35.87 |
Isoelectric point | 6.96 |
Molecular weight | 15302.27 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP22021
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.83| 14| 39| 80| 93| 1
---------------------------------------------------------------------------
80- 93 (26.82/17.15) PSENHPLHNSGLLS
121- 134 (26.01/16.45) PRGPPALTSSGTLS
---------------------------------------------------------------------------
|