<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP22004
| Description |
mediator of RNA polymerase II transcription subunit 30 isoform X5 |
| Sequence | MSTPPLASSGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLAKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERREIAEVNKLYRFPPLTSGRSTTRQAKPRGHL |
| Length | 170 |
| Position | Head |
| Organism | Balaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Mysticeti>
Balaenopteridae> Balaenoptera.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.639 |
| Instability index | 47.01 |
| Isoelectric point | 8.84 |
| Molecular weight | 19142.55 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP22004
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.14| 12| 33| 47| 60| 1
---------------------------------------------------------------------------
47- 60 (16.25/19.19) RTMEIfqLLRNMQL
83- 94 (19.88/13.86) RQLSI..LFRKLRL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.47| 23| 33| 111| 133| 2
---------------------------------------------------------------------------
111- 133 (39.85/24.25) VEQLIPYVEEDGSKNDDRAGPPR
145- 167 (39.62/24.08) VNKLYRFPPLTSGRSTTRQAKPR
---------------------------------------------------------------------------
|