<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21995
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MAGSSRGEKEKERPGGGSGAAGGNSTRERLLSALEDLEVLSRYSHRETFLDHPVELIEMLAISRNQKLLQSGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAVSSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMAVNMLPPNHSSDFVLEPPGHNKENEDDVEVMSTDSSSSSSDSD |
Length | 282 |
Position | Middle |
Organism | Balaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Mysticeti>
Balaenopteridae> Balaenoptera.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.693 |
Instability index | 48.65 |
Isoelectric point | 5.15 |
Molecular weight | 31124.43 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP21995
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 109.60| 29| 29| 65| 93| 1
---------------------------------------------------------------------------
28- 61 (29.82/17.03) .ERLLSALE...DLEVLSRYS.HRETfldhpvELIEMLA
65- 93 (50.27/33.20) NQKLLQSGE...ENQVLELLI.HRDG......EFQELMK
97- 124 (29.51/16.79) NQ.....GKihhEMQVLEKEVeKRDS......DIQQLQK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.68| 19| 23| 226| 247| 2
---------------------------------------------------------------------------
226- 244 (35.91/30.83) D.VLAPQYPWQSNDMAVNML
251- 270 (29.77/14.37) DfVLEPPGHNKENEDDVEVM
---------------------------------------------------------------------------
|