<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21994
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MAGSSRGEKEKERPGGGSGAAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQSGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAVSSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMAVNMLPPNHSSDFVLEPPGHNKENEDDVEVMSTDSSSSSSDSD |
| Length | 270 |
| Position | Middle |
| Organism | Balaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Mysticeti>
Balaenopteridae> Balaenoptera.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.681 |
| Instability index | 49.58 |
| Isoelectric point | 5.08 |
| Molecular weight | 29641.83 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21994
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 92.67| 27| 28| 62| 88| 1
---------------------------------------------------------------------------
37- 56 (24.35/12.50) ....LEVL..SR..ELIEMLAISRNQKL
62- 88 (46.71/29.30) ENQVLELLI.HRDGEFQELMKLALNQGK
92- 112 (21.61/10.43) EMQVLEKEVeKRDSDIQQLQK.......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.68| 19| 23| 214| 235| 2
---------------------------------------------------------------------------
214- 232 (35.91/25.73) D.VLAPQYPWQSNDMAVNML
239- 258 (29.77/12.00) DfVLEPPGHNKENEDDVEVM
---------------------------------------------------------------------------
|