<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21992

Description mediator of RNA polymerase II transcription subunit 25
SequenceMVPGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFDDFKKMREQIGQTHRVCLLICNSPPYLLPAVESTTYSGCTTETLVQKIGERGIYFSIVSPRKLPALRLLFEKAAPPAMLEPLQPPADVSQDPRHMVLVRGLVLPVGGGSAPGPLQPKQPVPLPPAPPSGATLSAAPQQPLPPVPQQYQVPGNLSAAQVAAQNAVEAAKNQKAGLGPRFSPINPLQQAAPGVGPPYSQAQAPPLPPGPPGAPKPPPASQPSLVSTVAPGPGLAPPAQPGAPSMAGTVAPGGVSGPSPAQLGAPALGGQQSVSNKLLAWSGVLEWQEKPKPASVDANTKLTRSLPCQVYVNHGENLKTEQWPQKLYMQLIPQQLLTTLGPLFRNSRMVQFHFTNKDLDSLKGLYRIMGNGFAGCVHFPHTAPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNGIRQVITNHKQVQQQKLEQQRGMGAQQAPPGLGPILEDQARPSQNLVRXXPPQPQPQGTVGASTATGQPQPQGAAQAPPGAPQGPPGAAPGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPPTQSWTAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI
Length747
PositionUnknown
OrganismBalaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Mysticeti> Balaenopteridae> Balaenoptera.
Aromaticity0.06
Grand average of hydropathy-0.261
Instability index59.10
Isoelectric point8.71
Molecular weight78052.75
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP21992
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     373.65|      62|      62|     206|     267|       3
---------------------------------------------------------------------------
  215-  279 (110.92/24.62)	QDPRHMVLVRGLVLPVG.GG..SAPG...PLQPKQPVP......LP...P.AP.PSGATLSAAPQ..QP.................L...P.PvpqQYQ...V..........PGNLS
  293-  377 (75.93/14.23)	KNQKAGLGPRFSPINPL.QQ..AAPGvgpPYSQAQAPP......LP...P.GP.PG......AP...KPppasqpslvstvapgpgL...A.P...PAQ...PgapsmagtvaPGGVS
  379-  428 (49.48/ 6.38)	PSPAQ......LGAPAL.GGqqSVSN...KLLAWSGVL......EW...Q.EK.PKPASVDANTKltRS.................L...P...........................
  603-  665 (83.29/16.42)	QPQPQGAAQAPPGAPQGpPG..AAPG...P.....PPP......GPilrP.QN.PG.....ANPQ.lRS.................LllnP.P...PPQtgvP..........PPQAS
  683-  735 (54.03/ 7.73)	.........QGLGQPQL.G.....P....PLLHPPPPTqswtaqLP...PrAPlPGQMLLSGGPR..GP.................V...PqP...GLQ...P...............
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      76.22|      23|     110|      39|      69|       4
---------------------------------------------------------------------------
   39-   62 (41.28/15.48)	YLLPAIEYFN.GGPPAETdFGGDYG
  151-  174 (34.94/ 8.52)	YLLPAVESTTySGCTTET.LVQKIG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.89|      19|      24|     458|     476|       5
---------------------------------------------------------------------------
  458-  476 (35.90/22.37)	LTTLGPLFR...N..SRMVQFHFT
  480-  503 (26.99/15.10)	LDSLKGLYRimgNgfAGCVHFPHT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.02|      25|     103|     432|     456|       6
---------------------------------------------------------------------------
  432-  456 (48.31/34.80)	YVNHGENLKTEQ...WPQKLYMQ..LIPQQ
  533-  562 (32.71/20.87)	FVNGIRQVITNHkqvQQQKLEQQrgMGAQQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP21992 with Med25 domain of Kingdom Metazoa
Unable to open file!