Description | Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MTLERLAGRGQLAPGPLSHERQSLPWPVEKGGPSLSPTRVHGPLSERRCTCPKHTPVLLTIQEPRARAGPPPAIADAAEPPLPETKPLPPPQPPPPVSAPQPQPPPRPPSPAGVKAEENCSFLPLVHNIFKCMDKDSPDVHQDLNALKTKFQEMRKVVSAMPGIHLSPERQQQQLHRLREQVRTKNELLQKYKSLCMFEIPKE |
Length | 203 |
Position | Middle |
Organism | Balaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Mysticeti> Balaenopteridae> Balaenoptera. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.731 |
Instability index | 77.15 |
Isoelectric point | 9.34 |
Molecular weight | 22520.87 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP21980 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 140.96| 34| 36| 43| 77| 1 --------------------------------------------------------------------------- 16- 34 (30.14/ 6.46) .........PLSHERQSLP..WPV........EKGGPS 35- 71 (55.85/18.78) LS.PTRvhgPLSERRCTCPKHTPVLLTIQEPRARAGPP 72- 109 (54.97/21.07) PAiADAaepPLPETKPLPPPQPPPPVSAPQPQPPPRPP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MTLERL 2) VLLTIQ | 1 57 | 6 62 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab