<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21979

Description Mediator of RNA polymerase II transcription subunit 19
SequenceSTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKQKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGVGSSQASSSSSLR
Length171
PositionHead
OrganismBalaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Mysticeti> Balaenopteridae> Balaenoptera.
Aromaticity0.04
Grand average of hydropathy-1.274
Instability index66.81
Isoelectric point10.01
Molecular weight19228.79
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364151

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP21979
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      88.62|      28|     114|      26|      57|       1
---------------------------------------------------------------------------
   26-   57 (41.58/25.14)	KKVKEKLSN.FLPDLPGmIdlpGSHDNSSLRSL
  142-  170 (47.04/18.78)	KKEKKKKKNrHSPDHPG.V...GSSQASSSSSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.55|      16|      17|      97|     112|       2
---------------------------------------------------------------------------
   97-  112 (28.06/10.07)	PPKKKNKQKHKQSRTQ
  116-  131 (27.49/ 9.75)	PPETPSDSDHKKKKKK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP21979 with Med19 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) FLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKQKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGVGSSQASSSSSLR
35
171










Molecular Recognition Features






MoRF SequenceStartStop




1) SDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDH
123
156