<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21968
| Description |
Uncharacterized protein |
| Sequence | MAANFWTSTQLKWLMPKERLLRCQQEDRAKGLLESHIQQLKVYFTQYIYDMANSIKLRQRVAATAVVYFRRLCAGSSFSRHDPHLVAPGCLYLASKVEESVVAAKLLLASMKRLRPGWQYELKDLLDMEMVILDELDTHLVVFSPYLSLTKILESDAQLADLGQNAWAALNDVYRTDAPIIYAPHVLALGCLYLASVICSRDITAWLEGVDVDTNQIYAVALELISMYESYRVPISQEECARLLAVVRPPSAQQPTAAQLPPAGAGGSAAAGAAAGVQQQ |
| Length | 280 |
| Position | Kinase |
| Organism | Tetradesmus obliquus (Green alga) (Acutodesmus obliquus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Chlorophyta> core chlorophytes> Chlorophyceae>
CS clade> Sphaeropleales> Scenedesmaceae> Tetradesmus.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | 0.097 |
| Instability index | 40.58 |
| Isoelectric point | 5.97 |
| Molecular weight | 31002.49 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21968
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.52| 13| 100| 83| 95| 1
---------------------------------------------------------------------------
83- 95 (29.20/15.39) PHLVAPGCLYLAS
184- 196 (26.32/13.31) PHVLALGCLYLAS
---------------------------------------------------------------------------
|