<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21965
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MAENPEKLACYQAQTGVVESARFVLELEFIQCLANPHYLNWLAQNKYLEDKAFLNYLKYLEYWRQPQYASYIRFPHCLAMLDLLQSEHFRQAIVSPMVTEELHSQQFFYWAHYRTNRIKEAAAAAHAAGQAKEEAADGTQQADAVAAAAAVPPTEGAHRQPDA |
| Length | 163 |
| Position | Middle |
| Organism | Tetradesmus obliquus (Green alga) (Acutodesmus obliquus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Chlorophyta> core chlorophytes> Chlorophyceae>
CS clade> Sphaeropleales> Scenedesmaceae> Tetradesmus.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.369 |
| Instability index | 43.04 |
| Isoelectric point | 5.60 |
| Molecular weight | 18547.66 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21965
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 111.22| 28| 28| 11| 38| 1
---------------------------------------------------------------------------
4- 34 (39.58/23.03) NPEKlacYQAQTGVVESA....RFVLELEFIQCLA
35- 64 (46.49/28.08) NPHY.lnWLAQNKYLEDK....AFLNYLKYLEYWR
65- 85 (25.14/12.48) QPQY..............asyiRFPHCLAMLDLLQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.32| 18| 18| 119| 136| 2
---------------------------------------------------------------------------
119- 136 (28.43/14.34) KEAAAAAHAAGQAKEEAA
140- 157 (29.89/15.41) QQADAVAAAAAVPPTEGA
---------------------------------------------------------------------------
|