<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21951
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASKIETQNSSDTSPSSPKNIYKDPDDGRQRFLLELEFLQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNANFRNAMAHPINKELAHRQQFYFWKNYRNNRLKHILPRSLPEPSATTAVPAPASTTAQAPVSALPVPATSVAVTATPTQAPSPMPYGMPSGSALAKNDMRNPTVDNRRKRK |
| Length | 206 |
| Position | Middle |
| Organism | Mucuna pruriens (Velvet bean) (Dolichos pruriens) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Mucuna.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.609 |
| Instability index | 65.03 |
| Isoelectric point | 9.47 |
| Molecular weight | 23659.69 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21951
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.71| 15| 20| 150| 167| 1
---------------------------------------------------------------------------
150- 165 (23.34/13.42) TTAQAPvSALP..VPATS
171- 187 (27.37/ 7.97) TPTQAP.SPMPygMPSGS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.41| 18| 22| 38| 58| 2
---------------------------------------------------------------------------
38- 55 (33.55/12.25) FLQCLANPTYIHYLAQNR
68- 85 (35.87/16.40) YLQYWQRPEYIKFIMYPH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.81| 14| 22| 97| 110| 3
---------------------------------------------------------------------------
97- 110 (25.76/15.67) NFRNA.MAHPINKEL
121- 135 (21.05/11.69) NYRNNrLKHILPRSL
---------------------------------------------------------------------------
|