Description | Mediator of RNA polymerase II transcription subunit 11 (Fragment) |
Sequence | MTIFGIHHNEIPELEKEHKESTSMDSQGQTTSLQRLQNVEKRIVKVLELAGGIMDELASPVGPRKDVVQNHCLEFMQLIKMNQ |
Length | 83 |
Position | Head |
Organism | Mucuna pruriens (Velvet bean) (Dolichos pruriens) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Mucuna. |
Aromaticity | 0.02 |
Grand average of hydropathy | -0.482 |
Instability index | 44.77 |
Isoelectric point | 5.74 |
Molecular weight | 9455.79 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP21940 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) MTIFGIHHNEIPELEKEHKESTSM 2) QTTSLQRLQNVEKRIVKVL | 1 29 | 24 47 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab