<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21936
| Description |
Mediator of RNA polymerase II transcription subunit 30 (Fragment) |
| Sequence | MEEESVNGIISMSRSSSAKTTQELAMEGQKYLEETIENAFQILSSMNDELCNPVLWSTSPSSPNADSTSDNSNHHADIAAATAGAGGALEEARVRYKNAVAALRTILTAIPNSQKAKTFDAGAAASPADEAEIDKLEERASSLRRELANKNLHLKTLIDQLRDLITDISTWQSPFST |
| Length | 177 |
| Position | Head |
| Organism | Mucuna pruriens (Velvet bean) (Dolichos pruriens) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Mucuna.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.451 |
| Instability index | 61.11 |
| Isoelectric point | 4.74 |
| Molecular weight | 19096.89 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP21936
No repeats found
No repeats found
|