<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21932
Description |
Mediator of RNA polymerase II transcription subunit 32 (Fragment) |
Sequence | MSSTIWKVIILVTNTMDKVVNSLGSAYEDFVDAATEVLENKEKEDLDQITTDLALENFNQKRELFKVACDQAEEFVGSIKQRILSEWVVDEFTMSVTEETEKTEKKPVIEEKTGQNKPEIEEKTDVNKPETEEDRKSGTDTNDGKKKKKPATKKKKKNTSRV |
Length | 162 |
Position | Tail |
Organism | Mucuna pruriens (Velvet bean) (Dolichos pruriens) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Mucuna.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.973 |
Instability index | 45.29 |
Isoelectric point | 5.03 |
Molecular weight | 18505.58 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP21932
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.09| 17| 18| 88| 104| 2
---------------------------------------------------------------------------
88- 104 (28.01/13.61) VVDEFT.MSVTEETEKTE
108- 125 (24.08/10.85) VIEEKTgQNKPEIEEKTD
---------------------------------------------------------------------------
|