<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21923
| Description |
Mediator of RNA polymerase II transcription subunit 27 (Fragment) |
| Sequence | MASPMQMDDQNDQDASPSSLPSEKYASHLKIVSRQNSYSLLCRTFDSAMAECCHQESISLLAYSPLTTGILSGKYFFPGGGPTDVRLNHFKGKYSEGESRYNLSNKVTMTATVEYLNIAKTYGIHPVSLAIAFVLRHPLVASAIFGATKSWLTPRVHHVFRHITEYAATALQYFLGNQAETCLYSLWHWICSYQTLFSRPCSKCSRLLTMDKQSTLLLPPVNRSYWQFSFSKILLSNLTKDQNSNSTQAYHIGCLSEEV |
| Length | 259 |
| Position | Tail |
| Organism | Mucuna pruriens (Velvet bean) (Dolichos pruriens) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Mucuna.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.198 |
| Instability index | 51.85 |
| Isoelectric point | 8.56 |
| Molecular weight | 29136.86 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | D-threo-aldose 1-dehydrogenase activity GO:0047834 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP21923
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.19| 17| 18| 25| 41| 1
---------------------------------------------------------------------------
25- 41 (28.82/18.92) YASHLKIVSRQNSYSLL
45- 61 (31.37/21.16) FDSAMAECCHQESISLL
---------------------------------------------------------------------------
|