<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21904
| Description |
Mediator of RNA polymerase II transcription subunit 15a (Fragment) |
| Sequence | MSSIRSLLGQKLLGVASFISDIDINTAFNIEFMKESYLAELNELYQKLVTLPEREHFIVPDSIAQQLTPDQLEKLNVSKSNISPSFKEKLASYEKQIIQFIDTNRPMETMSPLQSGQLPPSHIDWQEKLYQKFSIQHSKS |
| Length | 140 |
| Position | Tail |
| Organism | Mucuna pruriens (Velvet bean) (Dolichos pruriens) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Mucuna.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.387 |
| Instability index | 51.04 |
| Isoelectric point | 5.59 |
| Molecular weight | 16089.20 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP21904
No repeats found
|