<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21886
| Description |
Mediator of RNA polymerase II transcription subunit 15a (Fragment) |
| Sequence | METKSKSTSASNMDTSNLNLMNSNNWRPNQGTNPTMDTSDWRAQLPHESRERIVNKIMDTLKKHLPVSGPDGLHELRKIAQRFEDKIFTDATSQDDYLRKISLKMLTMETKSQNTLASNIP |
| Length | 121 |
| Position | Tail |
| Organism | Mucuna pruriens (Velvet bean) (Dolichos pruriens) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Mucuna.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.960 |
| Instability index | 22.74 |
| Isoelectric point | 9.00 |
| Molecular weight | 13835.44 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP21886
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 78.39| 20| 21| 33| 52| 1
---------------------------------------------------------------------------
13- 30 (21.27/ 8.29) ...MDTSNLNLMNS.......NNWRpNQ
33- 52 (38.78/19.27) NPTMDTSDWRAQLP.......HESR.ER
55- 77 (18.35/ 6.45) NKIMDT..LKKHLPvsgpdglHELR...
---------------------------------------------------------------------------
|