<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21879
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MDDEETELRNPFPSPPSHYQRYTTHNLKLLDLLRQRAGEDADLSTLNQYEVLSDQTDVPEWPLAQLEKPRVDWILEEGHYTVFGDTWFVKEKIPSLEELGGHQLYPQDPSVDRRPALRSILRSMLVTYSKLLDAILAPPPTNSSQIEAEWKQHLEWINILAQNIMAAANDLRPVQARGNLELMMRRQLELRREETKAIHTKCDALEAQLAELRISAQTLVSATPAATTSKRAGGHMSSKVEPPDVSGMSTDAVLRWAEEVA |
Length | 261 |
Position | Middle |
Organism | Polyporus brumalis |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Polyporaceae> Polyporus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.530 |
Instability index | 65.52 |
Isoelectric point | 5.09 |
Molecular weight | 29584.09 |
Publications | PubMed=30061923
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP21879
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 135.96| 47| 92| 4| 67| 1
---------------------------------------------------------------------------
4- 65 (71.06/79.82) EETELRNPFPSPPSHYQRYTTHNL.........KLLDllrqragedADLS..TLNqyevlSDQTDvPEWP........LAQ
97- 162 (64.89/36.93) EELGGHQLYPQDPSVDRRPALRSIlrsmlvtysKLLD.........AILAppPTN.....SSQIE.AEWKqhlewiniLAQ
---------------------------------------------------------------------------
|