<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21863
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MAMATIPQPDLAMSTTAQETPPAMPSEEPKFGGFTRFEIELEFVQSLASPLYLNHLASLKYLESPPFIAYLSYLQYWAQPAYTKYLTYPGPTLKNLELLQQERFRADILSPDVVARLMDEGAKSAAEWPSS |
| Length | 131 |
| Position | Middle |
| Organism | Phialophora cf. hyalina BP 5553 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Pleuroascaceae> Venustampulla.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.205 |
| Instability index | 64.30 |
| Isoelectric point | 4.66 |
| Molecular weight | 14737.67 |
| Publications | PubMed=30018880
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21863
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.61| 21| 22| 55| 75| 1
---------------------------------------------------------------------------
55- 75 (37.93/17.79) HLASLKYLESP.PFIAYLSYLQ
79- 100 (34.69/15.83) QPAYTKYLTYPgPTLKNLELLQ
---------------------------------------------------------------------------
|