<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21861
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MAPLGQSDHDVVEKQLKEVIQDLYHVMVQVHAYDVAGKPSGSVLANQLNTLATDLQKIYDTARPSASRPDSSRPPVNLPSIPPELINYVDNGRNPDIYTREFVELARRGNQLMKGKIEAFGDFRDVLAAEMARAMPELREDVKKVVVETGGRREVVDEAIGQDAM |
Length | 165 |
Position | Middle |
Organism | Phialophora cf. hyalina BP 5553 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Pleuroascaceae> Venustampulla.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.442 |
Instability index | 45.63 |
Isoelectric point | 5.10 |
Molecular weight | 18312.54 |
Publications | PubMed=30018880
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP21861
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 106.52| 26| 27| 38| 63| 1
---------------------------------------------------------------------------
11- 31 (24.24/12.68) .....VVEKQLKEVIQDLYHVMVQVH
38- 63 (39.48/24.34) KPSGSVLANQLNTLATDLQKIYDTAR
68- 93 (42.80/26.89) RPDSSRPPVNLPSIPPELINYVDNGR
---------------------------------------------------------------------------
|