<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21854
| Description |
Uncharacterized protein |
| Sequence | MADRLTQLQDAVDQLANQFVASIYYTHKHHDLRTVSATDTVRADKKENEGASVDQDVEPYPTEQFKAGQRELAQDLILKEQQIEYLISVLPGLENSEKDQEQTIKQLEEDLKVAEEQRKEALQAKEAVLAKLDGVIRSIKRP |
| Length | 142 |
| Position | Middle |
| Organism | Phialophora cf. hyalina BP 5553 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Pleuroascaceae> Venustampulla.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.765 |
| Instability index | 43.13 |
| Isoelectric point | 4.85 |
| Molecular weight | 16172.88 |
| Publications | PubMed=30018880
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP21854
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.43| 17| 33| 70| 86| 1
---------------------------------------------------------------------------
70- 86 (27.90/15.55) RELAQDL.ILKEQQIEYL
105- 122 (22.52/11.47) KQLEEDLkVAEEQRKEAL
---------------------------------------------------------------------------
|