<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21840
Description |
GTP-binding nuclear protein |
Sequence | MADPSAPPATMAPATTDSLTQLQDCFDQLLTQMFASIRYIDTHHPYAQIEGQSDQSPATTAITQPQPPTQTTLPIHPSSNAISSDLAQPPQPPPAQTEAEIRFTSRPAFRPTLQELAQDLVLKEQQIEYLIDTLPGIGTSQLSQEARIRELEQELKEVSEERKKWVAVQEDLVGKVEDVIKGVRRV |
Length | 186 |
Position | Middle |
Organism | Venturia inaequalis (Apple scab fungus) |
Kingdom | Fungi |
Lineage | |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.529 |
Instability index | 70.61 |
Isoelectric point | 4.65 |
Molecular weight | 20622.91 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP21840
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.51| 10| 42| 13| 23| 1
---------------------------------------------------------------------------
13- 23 (14.53/ 9.35) PATTdSLTQLQ
57- 66 (19.98/ 8.67) PATT.AITQPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.43| 22| 25| 67| 91| 2
---------------------------------------------------------------------------
67- 88 (40.15/19.24) PPTQTTLPI....HPSSNAISSDLAQ
93- 118 (34.29/ 9.91) PPAQTEAEIrftsRPAFRPTLQELAQ
---------------------------------------------------------------------------
|