<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21840
| Description |
GTP-binding nuclear protein |
| Sequence | MADPSAPPATMAPATTDSLTQLQDCFDQLLTQMFASIRYIDTHHPYAQIEGQSDQSPATTAITQPQPPTQTTLPIHPSSNAISSDLAQPPQPPPAQTEAEIRFTSRPAFRPTLQELAQDLVLKEQQIEYLIDTLPGIGTSQLSQEARIRELEQELKEVSEERKKWVAVQEDLVGKVEDVIKGVRRV |
| Length | 186 |
| Position | Middle |
| Organism | Venturia inaequalis (Apple scab fungus) |
| Kingdom | Fungi |
| Lineage | |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.529 |
| Instability index | 70.61 |
| Isoelectric point | 4.65 |
| Molecular weight | 20622.91 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP21840
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.51| 10| 42| 13| 23| 1
---------------------------------------------------------------------------
13- 23 (14.53/ 9.35) PATTdSLTQLQ
57- 66 (19.98/ 8.67) PATT.AITQPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.43| 22| 25| 67| 91| 2
---------------------------------------------------------------------------
67- 88 (40.15/19.24) PPTQTTLPI....HPSSNAISSDLAQ
93- 118 (34.29/ 9.91) PPAQTEAEIrftsRPAFRPTLQELAQ
---------------------------------------------------------------------------
|