<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21838
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MTEEAPRSAEEPKQVPDEPRYGGFSRFELELECLSNPWYIHELWRRKLFEEKEFVAYLDYLQYFKHPKYARFLSYPGTTLQNLELLQQDSFRKECGNIGLIHKLCEEGIRSAEERPTS |
Length | 118 |
Position | Middle |
Organism | Venturia inaequalis (Apple scab fungus) |
Kingdom | Fungi |
Lineage | |
Aromaticity | 0.14 |
Grand average of hydropathy | -0.812 |
Instability index | 75.25 |
Isoelectric point | 5.28 |
Molecular weight | 14093.73 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP21838
No repeats found
|