<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21832
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MTTTIGIFLLTDQDQLQSLPNIKSKLISKFDPEPLGNWSLDHILFRSVEQDETNPPRFQHILRLGHRPQEAFVAVNQPRDKKDASNTKDLVITIPSNQLGSFTTLLRDRFVSLWTPRVSLRVTGGLAYKTGEFVVRIGELRQTGGQQPLRGVVCSIETKTTSTLEHSMPHQDHGVDEAEKTVLSEAWRSIGEDGAKENFTAYATEESIEAGFDEARLWCRILQLRV |
Length | 226 |
Position | Head |
Organism | Venturia inaequalis (Apple scab fungus) |
Kingdom | Fungi |
Lineage | |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.428 |
Instability index | 49.94 |
Isoelectric point | 5.89 |
Molecular weight | 25484.49 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP21832
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.92| 11| 35| 69| 79| 1
---------------------------------------------------------------------------
69- 79 (19.41/10.92) QEAFVAVNQPR
107- 117 (21.52/12.73) RDRFVSLWTPR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.46| 19| 37| 157| 178| 2
---------------------------------------------------------------------------
157- 178 (28.57/25.60) ETKTTSTLEHSMphqDHGVDEA
197- 215 (32.89/19.60) ENFTAYATEESI...EAGFDEA
---------------------------------------------------------------------------
|