<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21821
| Description |
Mediator of RNA polymerase II transcription subunit 28 |
| Sequence | MSENLIDQLEDNLKDCVNCIGKKLGEEDLKVVTDKFIECSQRVEDYFLKYGITQNKVKNITYGDVAQLKDELERKELLLKRNLDKLTEYQSTLDQLHQQDLTKWKE |
| Length | 106 |
| Position | Head |
| Organism | Trichoplax sp. H2 |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Placozoa> Trichoplacidae> Trichoplax>
unclassified Trichoplax.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.814 |
| Instability index | 39.22 |
| Isoelectric point | 4.97 |
| Molecular weight | 12526.10 |
| Publications | PubMed=30042472
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP21821
No repeats found
No repeats found
|