<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21816
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MDNSQVIPSNGDSDAMEIETANQLADDEAKDNNDDSIQRKRFLVELEFVQALANPQYLNFLAQHGYLRDSAFINYLDYLQYWKQQEYVKFVKYPQCLHFLDLLQSEHFRRELINNPCAKFIEEQQLLHWQYNTQSKIKAVVEAARQIKQESGINRSQYNNETVIKR |
Length | 166 |
Position | Middle |
Organism | Trichoplax sp. H2 |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Placozoa> Trichoplacidae> Trichoplax>
unclassified Trichoplax.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.735 |
Instability index | 48.10 |
Isoelectric point | 5.22 |
Molecular weight | 19667.74 |
Publications | PubMed=30042472
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP21816
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.94| 23| 27| 75| 99| 1
---------------------------------------------------------------------------
75- 99 (39.05/33.51) YLDYLQYwkQQEYV.....KFVKYPQCLHF
102- 129 (32.89/20.19) LLQSEHF..RRELInnpcaKFIEEQQLLHW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.21| 12| 27| 17| 28| 3
---------------------------------------------------------------------------
17- 28 (19.27/ 8.81) EIETANQLADDE
45- 56 (19.94/ 9.27) ELEFVQALANPQ
---------------------------------------------------------------------------
|