| Description | Mediator of RNA polymerase II transcription subunit 22 |
| Sequence | MSPVGGEQQSRLQEINSKNYLRRVKDDVKSILDNFTSILSASKVKEESQLNGSAQSVMDRYEMHVRSSNITRAAESLVQLIDELKESLILDDFTSLNEANDAKRKQFEQYIQHSNSELQKIKHGIGQDLQQLETEYYNSAYK |
| Length | 142 |
| Position | Head |
| Organism | Trichoplax sp. H2 |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Placozoa> Trichoplacidae> Trichoplax> unclassified Trichoplax. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.823 |
| Instability index | 67.81 |
| Isoelectric point | 5.41 |
| Molecular weight | 16301.91 |
| Publications | PubMed=30042472 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP21814
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.57| 20| 55| 26| 45| 1
---------------------------------------------------------------------------
26- 45 (33.77/22.74) DDVKS..ILDNFTSILSASKVK
82- 103 (29.79/19.41) DELKEslILDDFTSLNEANDAK
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) AKRKQFEQYIQ 2) LETEYYNSAYK 3) LILDDF 4) QSVMDRYEMHVR | 102 132 88 55 | 112 142 93 66 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab