| Description | Uncharacterized protein |
| Sequence | MSEIPQTDVSRPSALPTAKFSQRGTVSQSSIDQNSAEYLDAIEEEWNKRVDMEVETLVDGMVDLVSLASVSDKDKFRIAQESFQAQSRAESMVRAANSLLSITHSMKLLLLLSDEAQLAHRRDAELKVVQEERDDARQKVADLLDDILRRKAS |
| Length | 153 |
| Position | Head |
| Organism | Hypsizygus marmoreus (White beech mushroom) (Agaricus marmoreus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Agaricales> Lyophyllaceae> Hypsizygus. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.476 |
| Instability index | 52.78 |
| Isoelectric point | 4.82 |
| Molecular weight | 17162.06 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP21794 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) DKFRIA 2) QKVADLLDDILRRKA | 74 138 | 79 152 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab