Description | Uncharacterized protein |
Sequence | MSEIPQTDVSRPSALPTAKFSQRGTVSQSSIDQNSAEYLDAIEEEWNKRVDMEVETLVDGMVDLVSLASVSDKDKFRIAQESFQAQSRAESMVRAANSLLSITHSMKLLLLLSDEAQLAHRRDAELKVVQEERDDARQKVADLLDDILRRKAS |
Length | 153 |
Position | Head |
Organism | Hypsizygus marmoreus (White beech mushroom) (Agaricus marmoreus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Agaricales> Lyophyllaceae> Hypsizygus. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.476 |
Instability index | 52.78 |
Isoelectric point | 4.82 |
Molecular weight | 17162.06 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP21794 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) DKFRIA 2) QKVADLLDDILRRKA | 74 138 | 79 152 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab