<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21793
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MLPVRTTTLEPFRSHTAPRLSTLPVILIASSSMDINDLHPPDDYSHRFFIWHEWIQANGPLTTENVFDYFATSMFYDKQSNNQVLRMQTIHTGMPILNEAEELKRFTGVEFALVHAQPPSMFIIQKRERLSPEEVRPLAAYFIMNNRIYQSPDVYTVLSNRLLTSLHSLQSSLDILRVHRPDYTPRTGFVWPITDPSLPVEAAKKRTTGEDIIIADESGSTLPPLKSKYLTEAPKRQQNNMLLLNAMRATAAHSKMSLPLSTFASNLESVPSETPVAHQRSSATPGPSSSQGTTPKVVQSAPTPQEPVKAPPGGGKKKRKRTSLAAPSVPG |
| Length | 331 |
| Position | Head |
| Organism | Hypsizygus marmoreus (White beech mushroom) (Agaricus marmoreus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Lyophyllaceae> Hypsizygus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.406 |
| Instability index | 62.14 |
| Isoelectric point | 9.44 |
| Molecular weight | 36817.60 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21793
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.92| 20| 137| 31| 51| 1
---------------------------------------------------------------------------
31- 51 (39.19/30.35) SSMDINDLHPPdDYSHRF.FIW
171- 191 (36.73/23.08) SSLDILRVHRP.DYTPRTgFVW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.73| 17| 17| 117| 133| 3
---------------------------------------------------------------------------
117- 133 (31.60/17.05) QP.PSMFIIQKRERLSPE
136- 153 (28.13/14.56) RPlAAYFIMNNRIYQSPD
---------------------------------------------------------------------------
|