<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21790
Description |
Uncharacterized protein |
Sequence | MQADKITTLQAQIQSLADLHSCIPSLRQIPPLLLETPVTNGLPLSTQSLRPQFHHIKDISDTIRTDPIQEALRTARDTLRADTTDLHPNFRRENRKRRRPPSPGSPQPYVALERKTTSLFPPGAEGIHALKFEGLSSFIDEFNNAQQAKLHLWKRTHGTTQANEPIIVRLTIPDVLIAYVTLVTDAATSDLFCESLTAFGPRERKSPHSQSDFSVYRILSQQAAKMLHSHPRVSVQGVMNLLCSYSGLFVDRCVRCGRVLSTEGHVPPVVRIWDDGGWSARHVACRLEA |
Length | 289 |
Position | Tail |
Organism | Hypsizygus marmoreus (White beech mushroom) (Agaricus marmoreus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Lyophyllaceae> Hypsizygus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.345 |
Instability index | 44.78 |
Isoelectric point | 9.13 |
Molecular weight | 32345.55 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP21790
No repeats found
No repeats found
|