Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSAHPQTPQSPCRFSPATSSDSVMGLAVASAASASTSAAAAAASSSSTSACSLATLPTPAHSVNGANSQLDLNLVDSPHKRKRTLDDSGSGRDRKKMHRDDDDDDDRMGIEDLHLDVGRKYLLCQNKYPESLPPTSEDLYQMFGLTALAAEVAREKPNGEKNALRKTYKGHIKRLGVAGHFDVQKKNEDAPSDFLAMLAVPELEWNVHQVKGRDIGQGLSETTLSNLGRAVTLSRGSLPKSVWDSSVLGDLAPTASDGSKPQSAKATAPSTPLASTPNAMGRSSKGAQLPAVSGPDVARPRRNNKKRSYGDSSFEGYGEGYPDDDAGVDTGYSTGEGDGGQKRRKKNPGNSPTYSSMRQQSYGPGMVGA |
Length | 369 |
Position | Head |
Organism | Ophiocordyceps sp. 'camponoti-saundersi' |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Ophiocordyceps. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.740 |
Instability index | 50.89 |
Isoelectric point | 8.28 |
Molecular weight | 38937.55 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP21780 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 383.27| 120| 221| 16| 144| 1 --------------------------------------------------------------------------- 16- 144 (184.57/93.49) PATSSD.SVMGlAVASAASASTSAAAAAASSSSTsacSLATLPTP.AHSVNGAN.SQLDLNLVDSPHK..RKRTLDDSgSGRDRKKMHRDDDDDDDrMGIEDLHLDVGRKYllcQNKYPESLPPTSEDLYQMFG 239- 363 (198.71/81.32) PKSVWDsSVLG.DLAPTASDGSKPQSAKATAPST...PLASTPNAmGRSSKGAQlPAVSGPDVARPRRnnKKRSYGDS.SFEGYGEGYPDDDAGVD.TGYSTGEGDGGQKR...RKKNPGNSPTYSSMRQQSYG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GQKRRKKNPG 2) RKKMHR 3) TYSSMR | 340 94 353 | 349 99 358 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab