<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21772

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMALASKNGDGASEPLSARPRSRMNDLPDEIIHITQGFIPLSLLLTRLAQTTHNSLQEKVAELAKMPLPATAVNGNASNNAALALDDTSGENLRKKGSLASFAQDLHGKWLKALVITEWSRKSEMVSKLIDLKFHIDQQRILYDACLDNIINVKRDLTFARMPSPDLKTALQVLSAGRAPWMPDLNYIEPPKLTPREQLKWIDDLNTLLSLRLNLDDYDKIPYHFKNYEIASGRVTFKVDGEFHVDLTIADEDFEKQFWFIDFRYAFSPAPSSLPPSLRTYLEGCVNEALSKDGLTGCYRFLHEFVMTFKINELKRQAFQLSRSSWTGTLSVEPLNRSLAIQYWPSRASTTGSKSWILLAVNSGRKADGRLDEKATSFIVAKWYRDGKEVKDVEIELDLETLSAEGLLTTVIGRHIEHILMGVHDRLLTTARFRDRDARMVLDVSRTDPAMSSLSIQVSHSGEITLLVEPMTGIFALKPQSKFTVQHEHQLNNGRSMAEDGAACLENVRCLIMEDEINRRGSLMGWTVRKPPLSVEEAKSATKLRAWTRALWMQKDGWGAEWFMAVFLGLGSDEWWLLEVSVDAPATKPVSDSFNRSRHDSGRSVKFKSKLLLPKSPVDLSEVFWDKMTMFTTGIMAQSIDFRELHRHKIKSRPSNTMNLSLSQPVRMPSIEMPLSDVFPSMVSPDKPQDSPDRDLSADKIVPLSLMQKFTGAALTIKRAWADDLLLLNFTGIQCTPTRDDGPASKLVCLSDAVIRVRKPSRFAALRGMVDRGVTYNPRRGEFSLQIRRRLGEPMLEALKSRIKAVDRFVNLFEALAKAGGAVTTELMTLERVTFCYGKDPDDKDEAAKKTWRLSLDLSGDEIEVEVEDGNPHIHTMDLMRRLVNSDGGIGALMAWLPASLPALQAVSEINRKWAEVEAGHLELTAKTMGWMMIAYKVGTRTCVTLEIRMRQRRDEAWWHLLQSPDASIDDDKYSKALKAVWTKEGDGWLGLGTGAVGNPSGGVGRMLLAAHEAIRGVESHDVVVLE
Length1026
PositionTail
OrganismOphiocordyceps sp. 'camponoti-saundersi'
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Ophiocordyceps.
Aromaticity0.07
Grand average of hydropathy-0.281
Instability index40.84
Isoelectric point6.92
Molecular weight115070.78
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP21772
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.89|      17|      48|     688|     704|       1
---------------------------------------------------------------------------
  688-  704 (31.18/18.09)	QDSPDRDLS.ADKIVPLS
  733-  750 (28.71/16.08)	QCTPTRDDGpASKLVCLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     237.47|      66|     368|     498|     583|       3
---------------------------------------------------------------------------
  498-  569 (110.85/80.24)	EDGAA...CLENVRCLIMED.EInrrGSLMGWTvRKPPLSVE..EAKSATKLRAWTRA....LWMQKDGWGaeWFMAVFLGL
  867-  937 (88.03/46.88)	EDGNPhihTMDLMRRLVNSDgGI...GALMAWL....PASLPalQAVSEIN.RKWAEVeaghLELTAKTMG..WMMIAY.KV
  962-  991 (38.59/31.68)	..................................QSPDASID..DDKYSKALKA........VW.TKEGDG..W.....LGL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.70|      18|      19|     307|     325|       5
---------------------------------------------------------------------------
  307-  324 (31.03/28.05)	TFKINELKRQ.AFQL..SRSS
  328-  348 (21.68/ 9.62)	TLSVEPLNRSlAIQYwpSRAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     154.34|      51|     366|     200|     263|       6
---------------------------------------------------------------------------
  200-  263 (83.29/72.88)	WiddlntLLSLRLNLDDYDKIPYHFKNYEIASGR.VTFK...VDGEFHVDLTiadedfeKQFW.....F........IDFR
  575-  642 (71.05/40.36)	W......LLEVSVDAPATKPVSDSFNRSRHDSGRsVKFKsklLLPKSPVDLS.......EVFWdkmtmFttgimaqsIDFR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     129.59|      38|     506|     266|     304|      11
---------------------------------------------------------------------------
  266-  304 (64.72/46.03)	FSPAPSSLPPSLRTYLEGCVNEALsKDGLTGCYRFLHEF
  775-  812 (64.87/41.58)	YNPRRGEFSLQIRRRLGEPMLEAL.KSRIKAVDRFVNLF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP21772 with Med14 domain of Kingdom Fungi
Unable to open file!