| Description | Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MDKLIDSRFERLEKALSNLVDSVTKYHPSVSQAEELHAADAQLSLGLEEVQVHQNNNLHIQQLRRTSAALDSQIRDTLTSLATTRKDIVATQITKFSSEPSYPVAYDELLAYARRISKTTLPPAANLLTAFPSPEMLTPAAATATAEQPPSAATPSGRTPSRTESPVANGASAQLPNAEQPAQQTSASQNTSLPEGMSQYLNPLSGQVFFPWPLEDKIRSGALASYQLLVEQGIDPRGYDPATEEERKRKEDEERKAKEEREKAEREERERQLREERERLRVERERQREKDQEEWRKTSIATGMPGAAVPVRSASGAGDKKQFQFTNLDDDDDDDDEG |
| Length | 338 |
| Position | Middle |
| Organism | Ophiocordyceps sp. 'camponoti-saundersi' |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Ophiocordyceps. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.919 |
| Instability index | 57.41 |
| Isoelectric point | 4.95 |
| Molecular weight | 37686.06 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP21763
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.94| 14| 15| 254| 267| 1
---------------------------------------------------------------------------
254- 267 (23.77/13.46) ERKAKEERE..KAERE
270- 285 (20.16/10.35) ERQLREERErlRVERE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.77| 13| 29| 100| 113| 3
---------------------------------------------------------------------------
100- 112 (23.68/17.68) PSYPVAYDELLAY
119- 131 (22.08/10.17) TTLPPAANLLTAF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.49| 13| 29| 30| 43| 4
---------------------------------------------------------------------------
7- 19 (19.37/ 6.49) SRFERLEKALSNL
31- 43 (22.12/14.09) SQAEELHAADAQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.13| 18| 30| 199| 219| 5
---------------------------------------------------------------------------
199- 219 (26.84/27.16) QYLNPlSGqvFFPWPLEDKIR
232- 249 (33.29/20.81) QGIDP.RG..YDPATEEERKR
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) AYDEL 2) WRKTSIATGMPGAAVPVRSASGAGDKKQFQFTNLDDDDDDDDEG | 105 295 | 109 338 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab