Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDKLIDSRFERLEKALSNLVDSVTKYHPSVSQAEELHAADAQLSLGLEEVQVHQNNNLHIQQLRRTSAALDSQIRDTLTSLATTRKDIVATQITKFSSEPSYPVAYDELLAYARRISKTTLPPAANLLTAFPSPEMLTPAAATATAEQPPSAATPSGRTPSRTESPVANGASAQLPNAEQPAQQTSASQNTSLPEGMSQYLNPLSGQVFFPWPLEDKIRSGALASYQLLVEQGIDPRGYDPATEEERKRKEDEERKAKEEREKAEREERERQLREERERLRVERERQREKDQEEWRKTSIATGMPGAAVPVRSASGAGDKKQFQFTNLDDDDDDDDEG |
Length | 338 |
Position | Middle |
Organism | Ophiocordyceps sp. 'camponoti-saundersi' |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Ophiocordyceps. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.919 |
Instability index | 57.41 |
Isoelectric point | 4.95 |
Molecular weight | 37686.06 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP21763 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 43.94| 14| 15| 254| 267| 1 --------------------------------------------------------------------------- 254- 267 (23.77/13.46) ERKAKEERE..KAERE 270- 285 (20.16/10.35) ERQLREERErlRVERE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 45.77| 13| 29| 100| 113| 3 --------------------------------------------------------------------------- 100- 112 (23.68/17.68) PSYPVAYDELLAY 119- 131 (22.08/10.17) TTLPPAANLLTAF --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 41.49| 13| 29| 30| 43| 4 --------------------------------------------------------------------------- 7- 19 (19.37/ 6.49) SRFERLEKALSNL 31- 43 (22.12/14.09) SQAEELHAADAQL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 60.13| 18| 30| 199| 219| 5 --------------------------------------------------------------------------- 199- 219 (26.84/27.16) QYLNPlSGqvFFPWPLEDKIR 232- 249 (33.29/20.81) QGIDP.RG..YDPATEEERKR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AYDEL 2) WRKTSIATGMPGAAVPVRSASGAGDKKQFQFTNLDDDDDDDDEG | 105 295 | 109 338 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab